PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM10G06920.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 361aa    MW: 40371.7 Da    PI: 4.7017
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM10G06920.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM40.49.1e-136211969128
              NAM  69 atgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      ++g+++  + k+gyWk  g+ + ++s  +  vg+k tL  y+g+ap+g++t Wvm+ey +
  OGLUM10G06920.1  62 KNGENAIIKSKTGYWKVVGTVRILTS--TVIVGMKVTLDHYEGQAPSGKRTGWVMNEYLI 119
                      345555557889*******9776666..899***************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100518.28211140IPR003441NAC domain
SuperFamilySSF1019411.27E-2119140IPR003441NAC domain
PfamPF023651.6E-620117IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MSSKVPGLAL LNTSISKSWS DEELVRFLAE RKEAHSLPEN VFVGMNISLI DPRNSDDPQS  60
PKNGENAIIK SKTGYWKVVG TVRILTSTVI VGMKVTLDHY EGQAPSGKRT GWVMNEYLIE  120
HNDEANLPQD YKNLCTIFFQ GDDILNAGDK QICLNANVPN ERKEFYLQYL AELEEQNAAW  180
NNQAVSVNEQ DVSSSKGLDG QKTSAADDQS VNHAPSREGY IELNDFLNSD SSASTSEYSS  240
QRTMISEEYF DSDAFLREIR NDHNAADEEH TDSKFSVAAA SKSDCVVISP PEQGFVNNLD  300
NHATITGDSP QKSVQNDKVD EHSRSMILRH AILVRTGCLN RFMPDLLIEH SQRRLQVLKQ  360
Q
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0726820.0AK072682.1 Oryza sativa Japonica Group cDNA clone:J023135B15, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015614544.10.0PREDICTED: protein ATAF2 isoform X1
RefseqXP_015614546.10.0PREDICTED: protein ATAF2 isoform X2
RefseqXP_015614547.10.0PREDICTED: protein ATAF2 isoform X2
TrEMBLA0A0E0B9F00.0A0A0E0B9F0_9ORYZ; Uncharacterized protein
STRINGBGIOSGA032080-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP109162632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.11e-13NAC domain containing protein 53